PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CA06g08530
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum
Family HD-ZIP
Protein Properties Length: 225aa    MW: 25988.9 Da    PI: 4.9329
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CA06g08530genomePEPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox62.65.8e-202070656
                S--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
    Homeobox  6 tftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56
                +f++eq+++Le++F+++ ++  +++ eLA+ lgL++rqV +WFqNrRa++k
  CA06g08530 20 RFSDEQVKALESMFKQKTKLEPSKKLELARDLGLQTRQVAIWFQNRRARWK 70
                69************************************************9 PP

2HD-ZIP_I/II113.31.6e-3619110493
  HD-ZIP_I/II   4 rrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEk..dyeaLkraydalkeenerLekeveeLreelke 93 
                  +r+s+eqvk+LE++F++++kLep++K elar+Lglq+rqva+WFqnrRAR+ktkqlE+  +y+ Lk+++d+l+ + ++L+ke+e+L ++lke
   CA06g08530  19 KRFSDEQVKALESMFKQKTKLEPSKKLELARDLGLQTRQVAIWFQNRRARWKTKQLEHehEYRLLKAEFDNLAVQFDSLKKEKESLLKQLKE 110
                  8*******************************************************86225778*************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007116.9731272IPR001356Homeobox domain
SMARTSM003892.0E-171476IPR001356Homeobox domain
SuperFamilySSF466891.84E-181874IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.9E-202079IPR009057Homeodomain-like
CDDcd000861.01E-152073No hitNo description
PfamPF000462.3E-172070IPR001356Homeobox domain
PRINTSPR000314.6E-64352IPR000047Helix-turn-helix motif
PROSITE patternPS0002704770IPR017970Homeobox, conserved site
PRINTSPR000314.6E-65268IPR000047Helix-turn-helix motif
PfamPF021838.6E-1172115IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 225 aa     Download sequence    Send to blast
MEAEDGLAEC SKKKCEDGKR FSDEQVKALE SMFKQKTKLE PSKKLELARD LGLQTRQVAI  60
WFQNRRARWK TKQLEHEHEY RLLKAEFDNL AVQFDSLKKE KESLLKQLKE LNDHLESNHA  120
DCNRRQDSIG SEVYTSSENV GTELDLKDNI PGCLNESLDH ERIKGADSDR EGTFIEYFRC  180
KEVAEFWNME ELGDSSLGSP EHWYAVGQGG SFEPSCANSK WWEF*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
16472RRARWKTKQ
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016574650.11e-161PREDICTED: homeobox-leucine zipper protein ATHB-12-like
TrEMBLM1A3K21e-113M1A3K2_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000139681e-112(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA20412363
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G46680.21e-30homeobox 7